PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0076300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GRAS
Protein Properties Length: 531aa    MW: 58901.5 Da    PI: 6.2329
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0076300genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4554.7e-1391615302374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      + L++cA+av+++++ +++ l a+l++++s +gdp+qRl ay++e+L arla+++s +ykal++++ +   s+e l+++++++ev+P++kf+++
  Spipo2G0076300 161 NQMLIACARAVADNNALMVELLTAELRQMVSVSGDPIQRLGAYLLEGLVARLASTGSCIYKALRCKQPA---SAELLSYMHILYEVCPYFKFGYM 252
                     689*****************************************************************9...9********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                      aN aI eav+ e+rvH++Df+i +G+QW++L+qaLa+Rp+gpp++RiTg+++p s   +   l+ +g+rLa++Ae+++vpfef++ +a + +++
  Spipo2G0076300 253 SANGAIAEAVKDENRVHVVDFQIAMGTQWVTLIQALAARPGGPPHVRITGIDDPVSAyaRGGGLHIVGRRLARLAESCNVPFEFHA-AALDGSEV 346
                     ******************************************************99999999************************.899***** PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     e+e+L v+pgEalaVn+++qlh+l+desvs++++rd+vL++vk+lsPkvv++veqe+++n+++Fl rf+e+l++y+a+f+s+++ lpres+eri+
  Spipo2G0076300 347 EVEHLGVRPGEALAVNFAYQLHHLPDESVSTRNHRDRVLRMVKGLSPKVVTLVEQESNTNTSPFLPRFAETLNHYTAVFESIDVRLPRESKERIS 441
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     vE+++l+r+ivn+vacegaer+erhe  +kWr+rl++aGF+p+pls  +++++k+ll+++  + yr+ee++g+l+lgWk+r+Lv+ SaWr
  Spipo2G0076300 442 VEQHCLARDIVNIVACEGAERVERHELHGKWRSRLTMAGFTPYPLSPLVNATIKSLLENYC-EHYRLEERDGALYLGWKNRALVVSSAWR 530
                     ************************************************************9.55*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098570.617134511IPR005202Transcription factor GRAS
PfamPF035141.6E-136161530IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    Send to blast
MQTSKKYEDS DDSQQSYYQR GMNCQNLPRD LRSLDHYYAN SGSHLGGTPA QALREQYCTL  60
ESSGTAGYSA HPSPCTQSLS SGSPTLQQDC QSDNTYGSPI NNSCITEDPN YLKHKMRELE  120
NAVLGSDLDV ADSSDSNYRG PPSMEPEMFR QIMEIPFGDL NQMLIACARA VADNNALMVE  180
LLTAELRQMV SVSGDPIQRL GAYLLEGLVA RLASTGSCIY KALRCKQPAS AELLSYMHIL  240
YEVCPYFKFG YMSANGAIAE AVKDENRVHV VDFQIAMGTQ WVTLIQALAA RPGGPPHVRI  300
TGIDDPVSAY ARGGGLHIVG RRLARLAESC NVPFEFHAAA LDGSEVEVEH LGVRPGEALA  360
VNFAYQLHHL PDESVSTRNH RDRVLRMVKG LSPKVVTLVE QESNTNTSPF LPRFAETLNH  420
YTAVFESIDV RLPRESKERI SVEQHCLARD IVNIVACEGA ERVERHELHG KWRSRLTMAG  480
FTPYPLSPLV NATIKSLLEN YCEHYRLEER DGALYLGWKN RALVVSSAWR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-671625306375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008800637.10.0PREDICTED: LOW QUALITY PROTEIN: chitin-inducible gibberellin-responsive protein 2-like
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLF6HHL90.0F6HHL9_VITVI; Putative uncharacterized protein
STRINGVIT_12s0057g00560.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein